PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019954P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 562aa    MW: 63129.2 Da    PI: 4.6309
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019954P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.2e-49171432128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtdeel+ +yLk k+ ++kl+l ++i+e+d+yk+eP +Lp + k+k+++++w+fFs+r+++y++ +r +rat+sgyWkatgkd+ + +
  MELO3C019954P1  17 PPGFRFHPTDEELILYYLKFKICRRKLKL-DIIRETDVYKWEPDELPgQsKLKTGDRQWFFFSPRERRYPNASRLSRATRSGYWKATGKDRIIQC 110
                     8****************************.99**************963589999**************************************99 PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfy grap+ge+tdWvmhey+l
  MELO3C019954P1 111 -NSRNVGVKKTLVFYLGRAPNGERTDWVMHEYTL 143
                     .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-5715166IPR003441NAC domain
PROSITE profilePS5100553.35516166IPR003441NAC domain
PfamPF023655.3E-2617143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MSTASSSKGL CDEGDWPPGF RFHPTDEELI LYYLKFKICR RKLKLDIIRE TDVYKWEPDE  60
LPGQSKLKTG DRQWFFFSPR ERRYPNASRL SRATRSGYWK ATGKDRIIQC NSRNVGVKKT  120
LVFYLGRAPN GERTDWVMHE YTLDEDELKR CKNVKDYYAL YKLYKKSGPG PKNGEQYGAP  180
FREEDWVDDA DCLEPQVKTV DEVDSVVRER DNGQIQLSSE DIEELMKQIV NDPVLELPSV  240
SGYHQLGSAL QVDDKEETAS TMIDAYAQEH ILPQADKVYH FSVQPSDLHA SFDFTQSGIS  300
QLQSFEAEVS SALKDCEEEG DFLEIYDLIG PEPTPVANVN PLGNIPPSEL DGLSELDLFH  360
DANMFLRDLG PITTETVLDP YLNALDVDVA NNLNGNLQHV SYQQNQTDDG FWKNNETENA  420
FSFHESHGQF VTQSTLGVGC ESVSSTAAGT RENQSANDGG GSTSWFSSNL WAFVESIPTT  480
PASASENVNR AFERMSSFSR LRLNTLNTLN TNVAVRNPER GARRRTGMNK GFFLFSILGV  540
LCAILWVLIG NVRLSGNCIS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-451716618165NO APICAL MERISTEM PROTEIN
1ut4_B6e-451716618165NO APICAL MERISTEM PROTEIN
1ut7_A6e-451716618165NO APICAL MERISTEM PROTEIN
1ut7_B6e-451716618165NO APICAL MERISTEM PROTEIN
4dul_A6e-451716618165NAC domain-containing protein 19
4dul_B6e-451716618165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818210.0LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456695.10.0PREDICTED: uncharacterized protein LOC103496564
TrEMBLA0A0A0K9G30.0A0A0A0K9G3_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-129NAC domain containing protein 17